.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zhv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein Atu071 from Agobacterium tumefaciens. Northeast Structural Genomics Consortium Target AtR8. To be Published
    Site NESGC
    PDB Id 1zhv Target Id AtR8
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS8737, Molecular Weight 13603.74 Da.
    Residues 127 Isoelectric Point 4.77
    Sequence mapriklkilngsygiarlsaseaipawadgggfvsitrtddelsivclidripqdvrvdpgwscfkfq gpfafdetgivlsvisplstngigifvvstfdgdhllvrsndlektadllanaghsll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.249
    Matthews' coefficent 2.12 Rfactor 0.241
    Waters 67 Solvent Content 42.06

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zhv
    1. His-tag impact on structure
    M Carson, DH Johnson, H McDonald - Section D: Biological , 2007 - scripts.iucr.org
     
    2. Progress in super long loop prediction
    S Zhao, K Zhu, J Li, RA Friesner - Proteins: Structure, Function, , 2011 - Wiley Online Library
     
    3. Towards High-resolution Computational Approaches for Structure-based Drug Discovery
    J Li - 2011 - academiccommons.columbia.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch