.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zkd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of the putative protein Q6N1P6 from Rhodopseudomonas palustris at the resolution 2.1 A , Northeast Structural Genomics Consortium target RpR58. To be Published
    Site NESGC
    PDB Id 1zkd Target Id RpR58
    Molecular Characteristics
    Source Rhodopseudomonas palustris
    Alias Ids TPS9049,PF02636 Molecular Weight 41322.88 Da.
    Residues 379 Isoelectric Point 5.56
    Sequence midqtalateikrlikaagpmpvwrymelclghpehgyyvtrdplgregdfttspeisqmfgellglws asvwkaadepqtlrlieigpgrgtmmadalralrvlpilyqslsvhlveinpvlrqkqqtllagirnih whdsfedvpegpavilaneyfdvlpihqaikretgwhervieigasgelvfgvaadpipgfeallppla rlsppgavfewrpdteilkiasrvrdqggaaliidyghlrsdvgdtfqaiashsyadplqhpgradlta hvdfdalgraaesigarahgpvtqgaflkrlgietralslmakatpqvsediagalqrltgegrgamgs mfkvigvsdpkietlvalsddtdreaerrqgthg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.258
    Matthews' coefficent 2.68 Rfactor 0.223
    Waters 271 Solvent Content 52.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zkd
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    2. COMPASS server for remote homology inference
    RI Sadreyev, M Tang, BH Kim - Nucleic acids research, 2007 - Oxford Univ Press
     
    3. MidA is a putative methyltransferase that is required for mitochondrial complex I function
    S Carilla-Latorre, ME Gallardo, SJ Annesley - Journal of Cell , 2010 - jcs.biologists.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch