.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zmb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6. To be Published
    Site NESGC
    PDB Id 1zmb Target Id CaR6
    Molecular Characteristics
    Source Clostridium acetobutylicum
    Alias Ids TPS8788,PF03629 Molecular Weight 32144.08 Da.
    Residues 282 Isoelectric Point 5.40
    Sequence mvksflmlgqsnmagrgfinevpmiyneriqmlrngrwqmmtepinydrpvsgislagsfadawsqknq ediiglipcaeggssidewaldgvlfrhalteakfamesseltgilwhqgesdslngnykvyykkllli iealrkelnvpdipiiigglgdflgkerfgkgcteynfinkelqkfafeqdncyfvtasgltcnpdgih idaisqrkfglryfeaffnrkhvleplinenellnlnyarthtkaekiyiksmdfalgkisydeftsel mkinnd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.61 Rfree 0.269
    Matthews' coefficent 2.80 Rfactor 0.243
    Waters 123 Solvent Content 55.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zmb
    1. Neisseria gonorrheae O-acetylpeptidoglycan esterase, a serine esterase with a Ser-His-Asp catalytic triad
    JT Weadge, AJ Clarke - Biochemistry, 2007 - ACS Publications
     
    2. Catalytic role of conserved HQGE motif in the CE6 carbohydrate esterase family
    N Lpez-Corts, D Reyes-Duarte, A Beloqui, J Polaina - FEBS letters, 2007 - Elsevier
     
    3. The structure at 1.6 A resolution of the protein product of the At4g34215 gene from Arabidopsis thaliana
    E Bitto, CA Bingman, JG McCoy, STM Allard - Section D: Biological , 2005 - scripts.iucr.org
     
    4. Structural and enzymatic characterization of NanS (YjhS), a 9? O? Acetyl N? acetylneuraminic acid esterase from Escherichia coli O157: H7
    ES Rangarajan, KM Ruane, A Proteau - Protein , 2011 - nparc.cisti-icist.nrc-cnrc.gc.ca
     
    5. Prdiction des rsidus impliqus dans le noyau du repliement et classification structurale de fragments protiques en interaction.
    N Prudhomme - 2009 - hal.archives-ouvertes.fr
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch