.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zno

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of VC0702 at 2.0 A: conserved hypothetical protein from Vibrio cholerae. Proteins 63 733-741 2006
    Site NESGC
    PDB Id 1zno Target Id VcP1
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS9228,3.90.950.10, PF01931 Molecular Weight 20560.55 Da.
    Residues 183 Isoelectric Point 6.98
    Sequence mppiikrrvmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrvr nakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqakelgdvmdevfg tenikqkggaiglltrhhltrstvyhqalilalipfinpehypsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.2629
    Matthews' coefficent 2.10 Rfactor 0.2296
    Waters 144 Solvent Content 40.70

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 3

    Jmol

     
    Google Scholar output for 1zno
    1. Catalytic mechanism of penicillin-binding protein 5 of Escherichia coli
    W Zhang, Q Shi, SO Meroueh, SB Vakulenko - Biochemistry, 2007 - ACS Publications
     
    2. Crystal structure of VC0702 at 2.0 : conserved hypothetical protein from Vibrio cholerae
    S Ni, F Forouhar, DE Bussiere - Proteins: Structure, , 2006 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch