.
The Open Protein Structure Annotation Network
PDB Keyword
.

1znp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of the hypothetical protein Q8U9W0 from Agrobacterium tumefaciens. Northeast Structural Genomics Consortium target AtR55. To be Published
    Site NESGC
    PDB Id 1znp Target Id AtR55
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS8734,PF06172, 2.60.120.10 Molecular Weight 15929.01 Da.
    Residues 146 Isoelectric Point 5.21
    Sequence mgtdmsaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtdavevwhyya gapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlvgctvspgfafssfvmaep gwspgdap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 7
    Resolution (Å) 2.50 Rfree 0.267
    Matthews' coefficent 2.10 Rfactor 0.209
    Waters 180 Solvent Content 42.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1znp
    1. Crystal structure of mammalian cysteine dioxygenase
    CR Simmons, Q Liu, Q Huang, Q Hao - Journal of Biological , 2006 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch