.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zxo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of the hypothetical protein Q8A1P1 at the resolution 3.2A. Northeast Structural Genomics Consortium target BtR25. To be Published
    Site NESGC
    PDB Id 1zxo Target Id BtR25
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS8777,PF01869 Molecular Weight 31154.41 Da.
    Residues 283 Isoelectric Point 8.15
    Sequence miliadsgstktdwcvvlngavikrlgtkginpffqseeeiqqkltasllpqlpegkfnavyfygagct pekapvlrraiadslpvignikansdmlaaahglcgqkagiacilgtgsnscfyngkeivsnisplgfi lgdegsgavlgkllvgdilknqlpatlkeeflkqfdltppeiidrvyrqpfpnrflaslspfiaqhlee pairqlvmnsfiaffrrnvmqydykqypvhfigsiaycykeilqdaarqtgiqigkilqspmegliqyh sqlsfhp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 3.20 Rfree 0.297
    Matthews' coefficent 3.40 Rfactor 0.241
    Waters 195 Solvent Content 64.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zxo
    1. Characterization of an N-acetylmuramic acid/N-acetylglucosamine kinase of Clostridium acetobutylicum
    J Reith, A Berking, C Mayer - Journal of bacteriology, 2011 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch