.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a7w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Phosphoribosyl-ATP Pyrophosphatase from Chromobacterium violaceum. NESG Target CVR7. To be Published
    Site NESGC
    PDB Id 2a7w Target Id CvR7
    Molecular Characteristics
    Source Chromobacterium violaceum
    Alias Ids TPS8813,PF01503 Molecular Weight 12138.25 Da.
    Residues 108 Isoelectric Point 5.94
    Sequence mtpdvlkniadtlearreaapqssyvaslfhkgedailkkvaeeaaetlmaskdkdklhlvrevadlwf htmvlltyhglrpedvvmelhrregisgldekasrkpta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.80 Rfree 0.2799
    Matthews' coefficent 2.58 Rfactor 0.2582
    Waters 339 Solvent Content 52.29

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2a7w
    1. De-orphaning the structural proteome through reciprocal comparison of evolutionarily important structural features
    RM Ward, S Erdin, TA Tran, DM Kristensen - PloS one, 2008 - dx.plos.org
     
    2. The conformational landscape of the ribosomal protein S15 and its influence on the protein interaction with 16S RNA
    T Crty, TE Malliavin - Biophysical journal, 2007 - Elsevier
     
    3. The 1.25 A resolution structure of phosphoribosyl-ATP pyrophosphohydrolase from Mycobacterium tuberculosis
    F Javid-Majd, D Yang, TR Ioerger - Section D: Biological , 2008 - scripts.iucr.org
     
    4. Structure of a putative NTP pyrophosphohydrolase: YP_001813558. 1 from Exiguobacterium sibiricum 255-15
    GW Han, MA Elsliger, TO Yeates, Q Xu - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch