.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a8e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Three-dimensional structure of Bacillus subtilis Q45498 putative protein at resolution 2.5A. Northeast Structural Genomics Consortium target SR204. To be Published
    Site NESGC
    PDB Id 2a8e Target Id SR204
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9073,PF06335 Molecular Weight 24615.02 Da.
    Residues 212 Isoelectric Point 6.40
    Sequence mtqmrfteedfntftiegldarmevlketvrpkltalgehfaptlsaltgdemfphvakharrsvnppa dswvafanskrgykklphfqiglweshvfvwfaiiyespikeeygkllevnqetitknipdsfvwsadh tkpgvhkqsemdkeqlktlferlqtvkkaellcgiqlqkeevlnmnnqeflqriddafkqlaflyrltq kvtqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.241
    Matthews' coefficent 3.40 Rfactor 0.196
    Waters 95 Solvent Content 63.50

    Ligand Information
    Ligands SO4 (SULFATE) x 2;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals

    Jmol

     
    Google Scholar output for 2a8e
    1. Estate Tax Consequences of Revenue Ruling 2004-64: Silence in Grantor Trusts Is Anything but Golden
    BM Beaman - Drake L. Rev., 2005 - HeinOnline
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch