.
The Open Protein Structure Annotation Network
PDB Keyword
.

2aca

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title
    Site NESGC
    PDB Id 2aca Target Id VpR19
    Molecular Characteristics
    Source Vibrio parahaemolyticus
    Alias Ids TPS9239,2.40.320.10, PF01928 Molecular Weight 21083.81 Da.
    Residues 181 Isoelectric Point 5.25
    Sequence mvsdahfqgqfevelkyrvknhdaflnmvkqiehevmfennqesdwfydtpqrtltqqgkslvlreiqp agiklwivkgpeadrceatnitkldsaqsmlenmgyeviqcskkirsiffvgefhitldfldgfghfae faimtddetalaryrerlvalaqqfhlseadrehrsykeilsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.25 Rfree 0.274
    Matthews' coefficent 2.20 Rfactor 0.227
    Waters 150 Solvent Content 44.00

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 5
    Metals

    Jmol

     
    Google Scholar output for 2aca
    1. Structure and TBP binding of the Mediator head subcomplex Med8Med18Med20
    L Larivire, S Geiger, S Hoeppner, S Rther - Nature structural & , 2006 - nature.com
     
    2. Research Non-homologous isofunctional enzymes: A systematic analysis of alternative solutions in enzyme evolution
    MV Omelchenko, MY Galperin, YI Wolf, EV Koonin - 2010 - biomedcentral.com
     
    3. Structure of the class IV adenylyl cyclase reveals a novel fold
    DT Gallagher, NN Smith, SK Kim, A Heroux - Journal of molecular , 2006 - Elsevier
     
    4. Structurefunction analysis of Plasmodium RNA triphosphatase and description of a triphosphate tunnel metalloenzyme superfamily that includes Cet1-like RNA
    C Gong, P Smith, S Shuman - RNA, 2006 - rnajournal.cshlp.org
     
    5. Structural basis for the catalytic mechanism of mammalian 25-kDa thiamine triphosphatase
    J Song, L Bettendorff, M Tonelli, JL Markley - Journal of Biological , 2008 - ASBMB
     
    6. Novel triphosphate phosphohydrolase activity of Clostridium thermocellum TTM, a member of the triphosphate tunnel metalloenzyme superfamily
    N Keppetipola, R Jain, S Shuman - Journal of Biological Chemistry, 2007 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch