.
The Open Protein Structure Annotation Network
PDB Keyword
.

2af7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the gamma-carboxymuconolactone decarboxylase from Methanobacterium thermoautotrophicum. To be Published
    Site NESGC
    PDB Id 2af7 Target Id TT747
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9211,PF02627, 1.20.1290.10 Molecular Weight 13967.24 Da.
    Residues 125 Isoelectric Point 5.04
    Sequence meryrrgmeilnrmnrksytairdeledvapdlarfvaefaygdvysrgvldlktrelltlaaltvlra ddqlkshvrgalnagcskdeiievmiqmavyagfpaainavlaakevftendpaev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 9
    Resolution (Å) 2.81 Rfree 0.292
    Matthews' coefficent 3.06 Rfactor 0.245
    Waters 94 Solvent Content 54.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2af7
    1. SISYPHUSstructural alignments for proteins with non-trivial relationships
    A Andreeva, A Prli_, TJP Hubbard - Nucleic acids , 2007 - Oxford Univ Press
     
    2. Crystal structure of the conserved protein TTHA0727 from Thermus thermophilus HB8 at 1.9 resolution: A CMD family member distinct from carboxymuconolactone
    K Ito, R Arai, E Fusatomi, T Kamo_Uchikubo - Protein , 2006 - Wiley Online Library
     
    3. Crystallization and preliminary X-ray crystallographic analysis of-carboxymucolactone decarboxylase from Sulfolobus solfataricus
    HY Lee, JK Yang - Section F: Structural Biology and Crystallization , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch