.
The Open Protein Structure Annotation Network
PDB Keyword
.

2afc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of Q8A8B0 hypothetical protein from Bacteroides thetaiotaomicron. To be Published
    Site NESGC
    PDB Id 2afc Target Id BtR9
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS8783,PF01661 Molecular Weight 17385.50 Da.
    Residues 155 Isoelectric Point 8.36
    Sequence meilyikgdatapigsgvkvithicndiggwgkgfvlalskkwkmpeeayrqwyksqeeftlgavqfvn venklyvanmigqhgiykdskglppirydavrqclkevalftiahkasvhmprigcglaggkwelmeqi ikeelitkeiavtvydl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.288
    Matthews' coefficent 2.00 Rfactor 0.215
    Waters 132 Solvent Content 39.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2afc
    1. Orphan Macrodomain Protein (Human C6orf130) Is an O-Acyl-ADP-ribose Deacylase
    FC Peterson, D Chen, BL Lytle, MN Rossi, I Ahel - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch