.
The Open Protein Structure Annotation Network
PDB Keyword
.

2aj2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of hypothetical protein VC0467 from Vibrio cholerae: new fold. Northeast Structural Genomics Consortium target VcR8. To be Published
    Site NESGC
    PDB Id 2aj2 Target Id VcR8
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS9232,PF02622, 3.40.1740.10, 3.30.70.1300 Molecular Weight 22105.82 Da.
    Residues 200 Isoelectric Point 4.97
    Sequence msnhssdievghsmnltnhflvampsmkdpyfkrsviyicehnqdgamglminapiditvggmlkqvdi epaypqshqenlkkpvfnggpvsedrgfilhrprdhyessmkmtddiavttskdiltvlgteaepegyi valgysgwsagqleveltenswltieadpelifntpvhekwqkaiqklgispaqlssdagha
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.21 Rfree 0.271
    Matthews' coefficent 2.67 Rfactor 0.258
    Waters 46 Solvent Content 54.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch