.
The Open Protein Structure Annotation Network
PDB Keyword
.

2akl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Sequence Specific Resonance Assignment of a Hypothetical Protein PA0128 from Pseudomonas Aeruginosa. J.Biomol.Nmr 36 27-27 2006
    Site NESGC
    PDB Id 2akl Target Id PaT1
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS9005,PF03831, 6746, 2.20.25.10, 2.30.30.40, PF08274 Molecular Weight 12163.25 Da.
    Residues 113 Isoelectric Point 5.07
    Sequence mstlppcpqcnseytyedgallvcpecahewspneaatasddgkvikdsvgnvlqdgdtitvikdlkvk gsslvvkvgtkvknirlvdgdhdidckidgigamklksefvrkv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2akl
    1. Sequence specific resonance assignment via Multicanonical Monte Carlo search using an ABACUS approach
    A Lemak, CA Steren, CH Arrowsmith - Journal of biomolecular , 2008 - Springer
     
    2. Domaindomain motions in proteins from time-modulated pseudocontact shifts
    X Wang, S Srisailam, AA Yee, A Lemak - Journal of biomolecular , 2007 - Springer
     
    3. Structure-oriented methods for protein NMR data analysis
    GA Bermejo, M Llins - Progress in nuclear magnetic resonance , 2010 - ncbi.nlm.nih.gov
     
    4. Changes in the microstructure of materials and their impact on reliability: experiments and modeling
    A Brandmair, T Bhme, WH Mller - Microsystem Technologies, 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch