The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of acyl carrier protein from Nitrosomonas europaea. Proteins 64 800-803 2006
    Site NESGC
    PDB Id 2amw Target Id NeT1
    Molecular Characteristics
    Source Nitrosomonas europaea
    Alias Ids TPS8984,6769, 1.10.1200.10, PF00550 Molecular Weight 9168.84 Da.
    Residues 83 Isoelectric Point 4.41
    Sequence mqhleavrnilgdvlnlgerkhtltassvllgnipeldsmavvnvitaleeyfdfsvdddeisaqtfet lgslalfvehklsh
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch