.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ap6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Hypothetical protein Atu4242 from Agrobacterium tumefaciens (strain C58 / ATCC 3 NESG Target ATR43. To be Published
    Site NESGC
    PDB Id 2ap6 Target Id AtR43
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS8733,3.30.70.900, PF07978 Molecular Weight 12168.54 Da.
    Residues 104 Isoelectric Point 6.74
    Sequence mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafsslddraerrar lmadprwlsflpkirdlievaenkimkparfsplm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.50 Rfree 0.2847
    Matthews' coefficent 2.41 Rfactor 0.1965
    Waters 184 Solvent Content 49.12

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ap6
    1. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    2. Symmetry versus Asymmetry in the Molecules of Life: Homomeric Protein Assemblies
    B Koji_-Prodi_, Z tefani_ - Symmetry, 2010 - mdpi.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch