.
The Open Protein Structure Annotation Network
PDB Keyword
.

2axo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hypothetical Protein AGR_C_4864 from Agrobacterium tumefaciens, NESG target AtR35. To be Published
    Site NESGC
    PDB Id 2axo Target Id AtR35
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS8732,PF06764 Molecular Weight 28391.00 Da.
    Residues 262 Isoelectric Point 7.62
    Sequence missirldlfrtkvfvmplkfplsicllgtflvtsaqaqeavkgvvelftsqgcascppadealrkmiq kgdvvglsyhvdywnylgwtdslaskenterqygymralgrngvytpqailngrdhvkgadvrgiydrl dafkregqglnvpvsskfagdeveidigagngkadvvvayftreqtvdvqkgenqgkkmsywhsvydvq tvgmwdgspmtvklpasvvakvkkggcavllqtanasgdpaaivgasillgnetq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.241
    Matthews' coefficent 1.60 Rfactor 0.203
    Waters 116 Solvent Content 23.10

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2axo
    1. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     
    2. Disulfide conformation and design at helix N_termini
    S Indu, ST Kumar, S Thakurela, M Gupta - Proteins: Structure, , 2010 - Wiley Online Library
     
    3. A Highly selective structure-based virtual screening model of Palm I allosteric inhibitors of HCV Ns5b polymerase enzyme and its application in the discovery and
    AH Mahmoud, DA Abou El Ella, MAH Ismail - European Journal of , 2012 - Elsevier
     
    4. Investigating diproline segments in proteins: Occurrences, conformation and classification
    I Saha, N Shamala - Biopolymers, 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch