.
The Open Protein Structure Annotation Network
PDB Keyword
.

2axp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hypothetical Protein BSU20280 from Bacillus subtilis, NESG target SR256. To be Published
    Site NESGC
    PDB Id 2axp Target Id SR256
    Related PDB Ids 3kb2 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS31732,PF02223, 3.40.50.300 Molecular Weight 19062.94 Da.
    Residues 165 Isoelectric Point 6.34
    Sequence mtliilegpdccfkstvaaklskelkypiikgssfelaksgneklfehfnkladednviidrfvysnlv yakkfkdysilterqlrfiedkikakakvvylhadpsvikkrlrvrgdeyiegkdidsilelyrevmsn aglhtyswdtgqwssdeiakdiiflve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.288
    Matthews' coefficent 3.80 Rfactor 0.255
    Waters 33 Solvent Content 66.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2axp
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch