.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ayj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of ribosomal protein L40E, a unique C4 zinc finger protein encoded by archaeon Sulfolobus solfataricus. Protein Sci. 17 589-596 2008
    Site NESGC
    PDB Id 2ayj Target Id SsT91
    Molecular Characteristics
    Source Sulfolobus solfataricus
    Alias Ids TPS9165,6747, PF01020 Molecular Weight 6444.56 Da.
    Residues 56 Isoelectric Point 10.82
    Sequence mpltdpaklqivqqrvflkkvcrkcgalnpiratkcrrchstnlrlkkkelptkkg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2ayj
    1. Cryo-EM Structure of the Archaeal 50S Ribosomal Subunit in Complex with Initiation Factor 6 and Implications for Ribosome Evolution
    BJ Greber, D Boehringer, V Godinic-Mikulcic - Journal of Molecular , 2012 - Elsevier
     
    2. Solution structure of ribosomal protein L40E, a unique C4 zinc finger protein encoded by archaeon Sulfolobus solfataricus
    B Wu, J Lukin, A Yee, A Lemak, A Semesi - Protein , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch