.
The Open Protein Structure Annotation Network
PDB Keyword
.

2azh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of Zn-Ligated Fe-S Cluster Assembly Scaffold Protein SufU From Bacillus subtilis. To be published
    Site NESGC
    PDB Id 2azh Target Id SR17
    Related PDB Ids 1xjs 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9070,3.90.1010.10, 6362, PF01592 Molecular Weight 16165.59 Da.
    Residues 147 Isoelectric Point 4.91
    Sequence msfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedakfegegcsis masasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvskfparikcatlswkalek gvakeeggn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2azh
    1. The asymmetric trimeric architecture of [2Fe-2S] IscU: Implications for its scaffolding during iron-sulfur cluster biosynthesis
    Y Shimomura, K Wada, K Fukuyama - Journal of molecular , 2008 - Elsevier
     
    2. Structural studies of the Enterococcus faecalis SufU [Fe-S] cluster protein
    GP Riboldi, H Verli, J Frazzon - BMC biochemistry, 2009 - biomedcentral.com
     
    3. Ironsulfur cluster biosynthesis: role of a semi-conserved histidine
    J Huang, JA Cowan - Chemical Communications, 2009 - pubs.rsc.org
     
    4. Mechanistic characterization of sulfur transfer from cysteine desulfurase SufS to the iron-sulfur scaffold SufU in Bacillus subtilis
    AG Albrecht, F Peuckert, H Landmann, M Miethke - FEBS letters, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch