.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b3w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the E.coli protein YbiA, Northeast Structural Genomics target ET24. To be Published
    Site NESGC
    PDB Id 2b3w Target Id ET24
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8868,PF08719, 6782 Molecular Weight 18668.37 Da.
    Residues 160 Isoelectric Point 9.42
    Sequence mpvraqriqhvmqdtiinfystsddygdfsnfaawpikvdgktwptsehyfqaqkfldekyreeirrvs spmvaarmgrdrskplrknwesvkeqvmrkalrakfeqhaelralllatapaklvehtendaywgdggh gkgknrlgyllmelreqlaiek
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2b3w
    1. Structural features and the persistence of acquired proteins
    HP Narra, MHJ Cordes, H Ochman - Proteomics, 2008 - Wiley Online Library
     
    2. Identification of novel components of NAD-utilizing metabolic pathways and prediction of their biochemical functions
    RF de Souza, L Aravind - Mol. BioSyst., 2012 - xlink.rsc.org
     
    3. Mathematical Modeling and Screening of Ligand Binding Sites in Protein using the Tetrahedral Motif Method and Double-Centroid Representation
    VM Reyes - 2012 - ritdml.rit.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch