.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b95

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of protein dynein light chain 2A, cytoplasmic; Northeast structural genomics consortium TARGET HR2106. To be Published
    Site NESGC
    PDB Id 2b95 Target Id HR2106
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8911,6210, PF03259, 3.30.450.30 Molecular Weight 10921.04 Da.
    Residues 96 Isoelectric Point 6.58
    Sequence maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdidpqndltfl rirskkneimvapdkdyfliviqnpte
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2b95
    1. Evaluating protein structures determined by structural genomics consortia
    A Bhattacharya, R Tejero - : Structure, Function, and , 2007 - Wiley Online Library
     
    2. Traditional biomolecular structure determination by NMR spectroscopy allows for major errors
    SB Nabuurs, CAEM Spronk, GW Vuister - PLoS computational , 2006 - dx.plos.org
     
    3. Simultaneous prediction of protein folding and docking at high resolution
    R Das, I Andr, Y Shen, Y Wu - Proceedings of the , 2009 - National Acad Sciences
     
    4. Assessing the accuracy of protein structures by quantum mechanical computations of 13C_ chemical shifts
    JA Vila, HA Scheraga - Accounts of chemical research, 2009 - ACS Publications
     
    5. Toward the quantum chemical calculation of nuclear magnetic resonance chemical shifts of proteins
    A Frank, I Onila, HM Mller - : Structure, Function, and , 2011 - Wiley Online Library
     
    6. Protein structure validation by generalized linear model root_mean_square deviation prediction
    A Bagaria, V Jaravine, YJ Huang - Protein , 2011 - Wiley Online Library
     
    7. Development and application of methodology for rapid NMR data collection and protein structure determination
    DM Parish - 2008 - books.google.com
     
    8. Influence of 1 H chemical shift assignments of the interface residues on structure determinations of homodimeric proteins
    YJ Lin, DK Kirchner, P Gntert - Journal of Magnetic Resonance, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch