.
The Open Protein Structure Annotation Network
PDB Keyword
.

2bco

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of succinylglutamate desuccinalase from Vibrio Parahaemolyticus (RIMD 2210633) at the resolution 2.3 A, Northeast Structural Genomics Target Vpr14. To be Published
    Site NESGC
    PDB Id 2bco Target Id VpR14
    Molecular Characteristics
    Source Vibrio parahaemolyticus
    Alias Ids TPS9237,PF04952, 3.40.630.10 Molecular Weight 38834.94 Da.
    Residues 342 Isoelectric Point 5.39
    Sequence mtkslfrqsfltdtldvhidvapaeqvlsngvqlklyqrgvlevipenptqetkniiiscgihgdetap melvdsiikdiesgfqkvdarclfiiahpestlahtrfleenlnrlfdekeheptkelaiadtlkllvr dfyqdtepktrwhldlhcairgskhytfavspktrhpvrskalvdfldsahieavllsnspsstfswys aenysaqaltmelgrvarigenaldrltafdlalrnliaeaqpehlskpcikyrvsrtivrlhddfdfm fddnvenftsfvhgevfghdgdkplmakndneaivfpnrhvaigqraalmvcevktrfeegelvyd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.33 Rfree 0.267
    Matthews' coefficent 2.54 Rfactor 0.213
    Waters 347 Solvent Content 51.52

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2bco
    1. Zinc through the three domains of life
    C Andreini, L Banci, I Bertini - Journal of proteome , 2006 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch