.
The Open Protein Structure Annotation Network
PDB Keyword
.

2bdq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative Copper Homeostasis Protein CutC from Streptococcus agalactiae, Northeast Strucural Genomics Target SaR15. To be Published
    Site NESGC
    PDB Id 2bdq Target Id SaR15
    Molecular Characteristics
    Source Streptococcus agalactiae
    Alias Ids TPS9117,PF03932, 3.20.20.380, 3.20.20.70 Molecular Weight 23370.59 Da.
    Residues 211 Isoelectric Point 5.15
    Sequence milrefcaenltdltrldkaiisrvelcdnlavggttpsygvikeanqylhekgisvavmirprggnfv yndlelrimeedilravelesdalvlgiltsnnhidteaieqllpatqglplvfhmafdvipksdqkks idqlvalgftrillhgssngepiienikhikalveyannrieimvgggvtaenyqyicqetgvkqahgt ritq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.271
    Matthews' coefficent 2.20 Rfactor 0.221
    Waters 216 Solvent Content 44.14

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2bdq
    1. Automatic procedure for using models of proteins in molecular replacement
    D Raimondo, A Giorgetti, S Bosi - PROTEINS: Structure, , 2007 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch