.
The Open Protein Structure Annotation Network
PDB Keyword
.

2bdr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative Ureidoglycolate hydrolase PP4288 from Pseudomonas putida, Northeast Structural Genomics Target PpR49. To be Published
    Site NESGC
    PDB Id 2bdr Target Id PpR49
    Molecular Characteristics
    Source Pseudomonas putida
    Alias Ids TPS9030,2.60.120.480, PF04115 Molecular Weight 18767.40 Da.
    Residues 167 Isoelectric Point 5.54
    Sequence mrtlmiepltkeafaqfgdvietdgsdhfminngstmrfhklatvetaepedkaiisifradaqdmplt vrmlerhplgsqafipllgnpflivvapvgdapvsglvrafrsngrqgvnyhrgvwhhpvltiekrddf lvvdrsgsgnncdehyfteeqmlilnphq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.218
    Matthews' coefficent 2.32 Rfactor 0.198
    Waters 335 Solvent Content 46.94

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 3

    Jmol

     
    Google Scholar output for 2bdr
    1. Automatic procedure for using models of proteins in molecular replacement
    D Raimondo, A Giorgetti, S Bosi - PROTEINS: Structure, , 2007 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch