The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative Gluconate Kinase from Bacillus halodurans, Northeast Structural Genomics Target BhR61. To be Published
    Site NESGC
    PDB Id 2bdt Target Id BhR61
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS8765, Molecular Weight 20255.07 Da.
    Residues 176 Isoelectric Point 4.94
    Sequence mkklyiitgpagvgksttckrlaaqldnsayiegdiinhmvvggyrppwesdellaltwknitdltvnf llaqndvvldyiafpdeaealaqtvqakvddveirfiilwtnreellrrdalrkkdeqmgerclelvee feskgideryfyntshlqptnlndivknlktnprfifc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.287
    Matthews' coefficent 2.15 Rfactor 0.233
    Waters 36 Solvent Content 42.88

    Ligand Information
    Ligands SO4 (SULFATE) x 1


    Google Scholar output for 2bdt
    1. FLORA: a novel method to predict protein function from structure in diverse superfamilies
    OC Redfern, BH Dessailly, TJ Dallman - PLoS computational , 2009 - dx.plos.org

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch