.
The Open Protein Structure Annotation Network
PDB Keyword
.

2bdv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the phage-related conserved hypothetical protein BB2244 from Bordetella bronchiseptica, Northeast Structural Genomics Target BoR24. To be Published
    Site NESGC
    PDB Id 2bdv Target Id BoR24
    Molecular Characteristics
    Source Bordetella bronchiseptica
    Alias Ids TPS8770,PF02586, 3.90.1680.10 Molecular Weight 24925.22 Da.
    Residues 223 Isoelectric Point 6.31
    Sequence mcgriaqksapedyveilwpnarlifddvagprynippgtrpltmhrlvdqaealarlpwgykphgssf fminakletierhgwpwklmigtgrilvpadgwyewkaldsgpkpakqpyyihgdapllfaglsawrrg aeldeahgfaivtndalggmvdvhdrrpvalppelarewvdpatpvarakeilraglpetafswypvrq evgsskyqlpdavdpl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.279
    Matthews' coefficent 1.80 Rfactor 0.212
    Waters 67 Solvent Content 31.80

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2bdv
    1. Formation of tight junction: determinants of homophilic interaction between classic claudins
    J Piontek, L Winkler, H Wolburg, SL Mller, N Zuleger - The FASEB Journal, 2008 - FASEB
     
    2. Molecular determinants of the interaction between Clostridium perfringens enterotoxin fragments and claudin-3
    L Winkler, C Gehring, A Wenzel, SL Mller - Journal of Biological , 2009 - ASBMB
     
    3. Automatic procedure for using models of proteins in molecular replacement
    D Raimondo, A Giorgetti, S Bosi - PROTEINS: Structure, , 2007 - Wiley Online Library
     
    4. Structure and function of extracellular claudin domains
    G Krause, L Winkler, C Piehl, I Blasig - Annals of the New , 2009 - Wiley Online Library
     
    5. On the interaction of Clostridium perfringens enterotoxin with claudins
    A Veshnyakova, J Protze, J Rossa, IE Blasig, G Krause - Toxins, 2010 - mdpi.com
     
    6. Mechanism of Clostridium perfringens Enterotoxin Interaction with Claudin-3/-4 Protein Suggests Structural Modifications of the Toxin to Target Specific Claudins
    A Veshnyakova, J Piontek, J Protze, N Waziri - Journal of Biological , 2012 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch