.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dlb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of hypothetical protein from Bacillus subtilis O34498 at the resolution of 1.2A. NESG target SR412. To be published
    Site NESGC
    PDB Id 2dlb Target Id SR412
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9093,PF09467 Molecular Weight 8077.71 Da.
    Residues 72 Isoelectric Point 4.33
    Sequence magylnnialnleivlknkadspevsetlvtricenlllskevsflkadgsvenfklsdmeyeitntee lpe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.20 Rfree 0.173
    Matthews' coefficent 2.71 Rfactor
    Waters 180 Solvent Content 52.83

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dlb
    1. The crystal structure of the AF2331 protein from Archaeoglobus fulgidus DSM 4304 forms an unusual interdigitated dimer with a new type of _+ _ fold
    S Wang, O Kirillova, M Chruszcz, D Gront - Protein , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch