.
The Open Protein Structure Annotation Network
PDB Keyword
.

2do8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of UPF0301 protein HD_1794. To be published
    Site NESGC
    PDB Id 2do8 Target Id HdR14
    Molecular Characteristics
    Source Haemophilus ducreyi
    Alias Ids TPS8930,PF02622, 7121, 3.40.1740.10, 3.30.70.1300 Molecular Weight 21001.55 Da.
    Residues 186 Isoelectric Point 4.52
    Sequence mfgnlqgkfiiatpemddeyfdrtviyicehndngtigviintptdlsvlelltrmdfqmakpriytqd qmvlnggpvnqdrgfivhsktdhefthsykvtdditlttsgdvldsfgtqtapekfivclgcstwkphq leqeiaqnywllseannqtlfetsyldrwveanemlgisgilapagra
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2do8
    1. Protein chaperones Q8ZP25_SALTY from Salmonella typhimurium and HYAE_ECOLI from Escherichia coli exhibit thioredoxin-like structures despite lack of canonical
    D Parish, J Benach, G Liu, KK Singarapu - Journal of structural and , 2008 - Springer
     
    2. Development and application of methodology for rapid NMR data collection and protein structure determination
    DM Parish - 2008 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch