.
The Open Protein Structure Annotation Network
PDB Keyword
.

2es9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Q8ZRJ2 from Salmonella typhimurium NESG TARGET STR65. To be Published
    Site NESGC
    PDB Id 2es9 Target Id StR65
    Related PDB Ids 2jn8 
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS9171,PF08986, 15089 Molecular Weight 11858.01 Da.
    Residues 107 Isoelectric Point 5.66
    Sequence mvnfkdksmptaiekaldfiggmntsasvphsmdestakgilkylhdlgvpvspevvvargeqegwnpe ftkkvagwaekvasgnriliknpeyfstymqeqlkelv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.26
    Matthews' coefficent 2.17 Rfactor 0.242
    Waters 163 Solvent Content 43.34

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2es9
    1. Novel protein folds and their nonsequential structural analogs
    A Guerler, EW Knapp - Protein Science, 2008 - Wiley Online Library
     
    2. Sequence and Structure Comparison Studies of Phycocyanin in Spirulina Platensis
    PTV Lakshmi, MS Uma, PP Karthikeyan - J Comput Sci Syst , 2008 - omicsonline.org
     
    3. Strategies for the structure-based analysis of protein functionality
    A Grler - 2009 - diss.fu-berlin.de
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch