.
The Open Protein Structure Annotation Network
PDB Keyword
.

2euc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of YfmB from bacillus subtilis NESG TARGET SR324. To be Published
    Site NESGC
    PDB Id 2euc Target Id SR324
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9079,PF11486 Molecular Weight 14033.21 Da.
    Residues 122 Isoelectric Point 5.53
    Sequence mqyfspeqqynawivsdlvkqifhkragcspgihelavfaeehfhididfvfsiimnigdiefaltdei ekklsgylstllpyvtadmfetskanahaflsrrhgnaayhlfvsddafmrkq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.328
    Matthews' coefficent 2.95 Rfactor 0.274
    Waters 216 Solvent Content 58.31

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch