.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eve

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics reveals EVE as a new ASCH/PUA-related domain. Proteins 75 760-773 2009
    Site NESGC
    PDB Id 2eve Target Id PsR62
    Molecular Characteristics
    Source Pseudomonas syringae
    Alias Ids TPS20390,3.10.590.10, PF01878 Molecular Weight 16823.27 Da.
    Residues 149 Isoelectric Point 5.89
    Sequence maywlmksepdefsisdlqrlgkarwdgvrnyqarnflrtmaegdefffyhsscpepgiagigkivkta ypdptaldpdshyhdakatteknpwsaldigfvdifknvlglgylkqqsqleqlplvqkgsrlsvmpvt aeqwaailalr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.217
    Matthews' coefficent 2.28 Rfactor 0.191
    Waters 218 Solvent Content 46.12

    Ligand Information
    Ligands MPO (3[N-MORPHOLINO]PROPANE) x 1;EDO (1,2-ETHANEDIOL) x 1;144 (TRIS-HYDROXYMETHYL-METHYL-AMMONIUM) x 1
    Metals

    Jmol

     
    Google Scholar output for 2eve
    1. The rough guide to in silico function prediction, or how to use sequence and structure information to predict protein function
    M Punta, Y Ofran - PLoS computational biology, 2008 - dx.plos.org
     
    2. Automatic procedure for using models of proteins in molecular replacement
    D Raimondo, A Giorgetti, S Bosi - PROTEINS: Structure, , 2007 - Wiley Online Library
     
    3. Structure of Lmaj006129AAA, a hypothetical protein from Leishmania major
    T Arakaki, I Le Trong, E Phizicky, E Quartley - Section F: Structural , 2006 - scripts.iucr.org
     
    4. Determining the DUF55-domain structure of human thymocyte nuclear protein 1 from crystals partially twinned by tetartohedry
    F Yu, A Song, C Xu, L Sun, J Li, L Tang - Section D: Biological , 2009 - scripts.iucr.org
     
    5. The YTH domain is a novel RNA binding domain
    Z Zhang, D Theler, KH Kaminska, M Hiller - Journal of Biological , 2010 - ASBMB
     
    6. Structural genomics reveals EVE as a new ASCH/PUA_related domain
    C Bertonati, M Punta, M Fischer - Proteins: Structure, , 2009 - Wiley Online Library
     
    7. Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of an ASCH domain-containing protein from Zymomonas mobilis ZM4
    SY Park, JH Park, JS Kim - Acta Crystallographica Section F: , 2011 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch