.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ew0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Novel x-ray structure of hypothetical protein Q6FF54 at the resolution 1.4 A. Northeast Structural Genomics target AsR1. TO BE PUBLISHED
    Site NESGC
    PDB Id 2ew0 Target Id AsR1
    Molecular Characteristics
    Source Acinetobacter sp. (strain adp1)
    Alias Ids TPS8726,PF02622, 3.40.1740.10, 3.30.70.1300 Molecular Weight 20604.09 Da.
    Residues 184 Isoelectric Point 4.77
    Sequence mtkqylthrcliappemaddffantviylarhddegaqgliinrpsgiqvrellndldieadhvqphev lqggplrpeagfvlhtgqpvwhssiavgenlcittskdildaiahnegvgryqialgyaswtknqlege isrgdwlicdadmdlifnlpyderwdaaykklgvdriwlsseigha
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.217
    Matthews' coefficent 2.61 Rfactor 0.2
    Waters 219 Solvent Content 52.95

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch