.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f6k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of ACMDS from Lactobacillus plantarum. To be Published
    Site NESGC
    PDB Id 2f6k Target Id LpR24
    Molecular Characteristics
    Source Lactobacillus plantarum
    Alias Ids TPS8956,PF04909, 3.20.20.140 Molecular Weight 34491.39 Da.
    Residues 307 Isoelectric Point 5.03
    Sequence mskidfhthylptsyvealkrhvpgdpdgwptpewtpqltlnfmrdndisysilslssphvnfgdkaet irlveaanddgkslaqqypdqlgylaslpipyeldavktvqqaldqdgalgvtvptnsrglyfgspvle rvyqeldarqaivalhpnepailpknvdidlpvpllgffmdttmtfinmlkyhffekypnikviiphag aflgivddriaqyaqkvyqvdvydvmhhvyfdvagavlprqlptlmslaqpehllygsdipytpldgsr qlghalattdlltneqkqaifydnahrllte
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.225
    Matthews' coefficent 2.95 Rfactor 0.192
    Waters 256 Solvent Content 58.24

    Ligand Information
    Ligands
    Metals MN (MANGANESE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch