.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f9f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative Mannosyl Transferase (wbaZ-1)from Archaeoglobus fulgidus. To be Published
    Site NESGC
    PDB Id 2f9f Target Id GR29A
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS8892,PF00534, 3.40.50.2000, PF02350 Molecular Weight 19217.26 Da.
    Residues 167 Isoelectric Point 8.62
    Sequence pvetskfkfkcygdfwlsvnriypekrielqlevfkklqdeklyivgwfskgdhaeryarkimkiapdn vkflgsvseeelidlysrckgllctakdedfgltpieamasgkpviavneggfketvinektgylvnad vneiidamkkvsknpdkfkkdcfrrakef
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.218
    Matthews' coefficent 1.71 Rfactor 0.186
    Waters 118 Solvent Content 28.41

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2f9f
    1. Crystal structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558
    KM Ruane, GJ Davies - : Structure, Function, and , 2008 - Wiley Online Library
     
    2. Purification, crystallization and preliminary crystallographic analysis of WsaF, an essential rhamnosyltransferase from Geobacillus stearothermophilus
    K Steiner, A Wojciechowska, C Schaffer - Section F: Structural , 2008 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch