.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fdf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB. Nature 439 879-884 2006
    Site NESGC
    PDB Id 2fdf Target Id ER126
    Related PDB Ids 2fdk 2fdj 2fdi 2fdh 2fdg 2fd8 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8824,2.60.120.590, BIG_205 Molecular Weight 24074.24 Da.
    Residues 216 Isoelectric Point 7.73
    Sequence mldlfadaepwqeplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgw tthrqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqdkdepd lrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplkagfhpltidcrynl tfrqagkke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.237
    Matthews' coefficent 2.03 Rfactor 0.193
    Waters 246 Solvent Content 39.43

    Ligand Information
    Ligands AKG (2-OXYGLUTARIC) x 1
    Metals CO (COBALT) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch