.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fdg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB. Nature 439 879-884 2006
    Site NESGC
    PDB Id 2fdg Target Id ER126
    Related PDB Ids 2fdk 2fdj 2fdi 2fdh 2fd8 2fdf 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8828,2.60.120.590, BIG_205 Molecular Weight 24074.24 Da.
    Residues 216 Isoelectric Point 7.73
    Sequence mldlfadaepwqeplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgw tthrqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqdkdepd lrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplkagfhpltidcrynl tfrqagkke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.231
    Matthews' coefficent 1.96 Rfactor 0.195
    Waters 119 Solvent Content 37.23

    Ligand Information
    Ligands SIN (SUCCINIC) x 1
    Metals FE2 (FE) x 1

    Jmol

     
    Google Scholar output for 2fdg
    1. Structural and mechanistic studies on the inhibition of the hypoxia-inducible transcription factor hydroxylases by tricarboxylic acid cycle intermediates
    KS Hewitson, BMR Linard, MA McDonough - Journal of Biological , 2007 - ASBMB
     
    2. Inhibition of 2-oxoglutarate dependent oxygenases
    NR Rose, MA McDonough, ONF King, A Kawamura - Chem. Soc. Rev , 2011 - xlink.rsc.org
     
    3. A DFT study of nucleobase dealkylation by the DNA repair enzyme AlkB
    H Liu, J Llano, JW Gauld - The Journal of Physical Chemistry B, 2009 - ACS Publications
     
    4. Structural and mechanistic studies on the inhibition of the HIF hydroxylases by tricarboxylic acid cycle intermediates
    KS Hewitson, BMR Linard, MA McDonough - Journal of Biological , 2006 - ASBMB
     
    5. Homology modeling and function prediction of hABH1, involving in repair of alkylation damaged DNA
    S Das, AS Vidyarthi - Interdisciplinary Sciences: Computational Life , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch