.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ffg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Novel x-ray structure of the YkuJ protein from Bacillus subtilis. Northeast Structural Genomics target SR360. To be Published
    Site NESGC
    PDB Id 2ffg Target Id SR360
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9085,PF08796 Molecular Weight 9244.11 Da.
    Residues 79 Isoelectric Point 4.55
    Sequence msqlmgiitrlqslqetaeaanepmqryfevngekicsvkyfeknqtfeltvfqkgekpntypfdnidm vsieifellq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.31 Rfree 0.26
    Matthews' coefficent 2.25 Rfactor 0.241
    Waters 67 Solvent Content 45.44

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ffg
    1. RDC_assisted modeling of symmetric protein homo_oligomers
    X Wang, S Bansal, M Jiang, JH Prestegard - Protein Science, 2008 - Wiley Online Library
     
    2. Determination of the structures of symmetric protein oligomers from NMR chemical shifts and residual dipolar couplings
    NG Sgourakis, OF Lange, F DiMaio - Journal of the , 2011 - ACS Publications
     
    3. Backbone resonance assignment and order tensor estimation using residual dipolar couplings
    P Shealy, Y Liu, M Simin, H Valafar - Journal of biomolecular NMR, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch