.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ffm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hypothetical Protein SAV1430 from Staphylococcus aureus, Northeast Structural Genomics ZR18. To be Published
    Site NESGC
    PDB Id 2ffm Target Id ZR18
    Related PDB Ids 1pqx 
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS9269,PF08712, 3.30.1370.70 Molecular Weight 9406.15 Da.
    Residues 83 Isoelectric Point 4.65
    Sequence mkiisisetpnhntmkitlsesregmtsdtytkvddsqpafindilkvegvksifhvmdfisvdkenda nwetvlpkveavfe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.51 Rfree 0.293
    Matthews' coefficent 2.33 Rfactor 0.248
    Waters 26 Solvent Content 47.21

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ffm
    1. A large data set comparison of protein structures determined by crystallography and NMR: statistical test for structural differences and the effect of crystal packing
    M Andrec, DA Snyder, Z Zhou, J Young - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Prediction of functional sites based on the fuzzy oil drop model
    M Bryli_ski, K Prymula, W Jurkowski - PLoS computational , 2007 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch