.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fgx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of Nitrosomonas Europaea Hypothetical Protein Ne2328: Northeast Structural Genomics Consortium Target NeT3. To be Published
    Site NESGC
    PDB Id 2fgx Target Id NeT3
    Molecular Characteristics
    Source Nitrosomonas europaea
    Alias Ids TPS8985,PF05768, 6929, 3.40.30.10 Molecular Weight 9927.87 Da.
    Residues 85 Isoelectric Point 5.04
    Sequence mnnqveprklvvygregchlceemiaslrvlqkkswfelevinidgnehltrlyndrvpvlfavnedke lchyfldsdvigayls
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fgx
    1. Synthesis and biological evaluation of chromium bioorganometallics based on the antibiotic platensimycin lead structure
    M Patra, G Gasser, A Pinto, K Merz, I Ott - , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch