.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fj6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the UPF0346 protein yozE from Bacillus subtilis. Northeast Structural Genomics target SR391. To be Published
    Site NESGC
    PDB Id 2fj6 Target Id SR391
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9090,PF06855, 6976, 1.10.150.260 Molecular Weight 8911.28 Da.
    Residues 74 Isoelectric Point 5.33
    Sequence mksfyhyllkyrhpkpkdsisefanqayedhsfpktstdyheissylelnadylhtmatfdeawdqyes evhgr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fj6
    1. Bypassing stereoselectivity in the early steps of alkaloid biosynthesis
    P Bernhardt, N Yerkes, SE O'Connor - Organic & biomolecular , 2009 - pubs.rsc.org
     
    2. Three structural representatives of the PF06855 protein domain family from Staphyloccocus aureus and Bacillus subtilis have SAM domain-like folds and different
    GVT Swapna, P Rossi, AF Montelione - Journal of structural and , 2012 - Springer
     
    3. Purification and substrate specificity of new C. roseus enzymes
    SE O'Connor, NNM Yerkes - 2010 - dspace.mit.edu
     
    4. Estate Tax Consequences of Revenue Ruling 2004-64: Silence in Grantor Trusts Is Anything but Golden
    BM Beaman - Drake L. Rev., 2005 - HeinOnline
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch