.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fki

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of protein yjbR from Escherichia coli reveals 'double-wing' DNA binding motif. Proteins 67 501-504 2007
    Site NESGC
    PDB Id 2fki Target Id ER226
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8836,PF04237, 7281 Molecular Weight 13518.79 Da.
    Residues 118 Isoelectric Point 6.06
    Sequence mtisellqycmakpgaeqsvhndwkatqikvedvlfamvkevenrpavslktspelaellrqqhsdvrp srhlnkahwstvyldgslpdsqiyylvdasyqqavnllpeekrkllvql
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fki
    1. NMR structure of protein yjbR from Escherichia coli reveals 'double_wing'DNA binding motif
    KK Singarapu, G Liu, R Xiao, C Bertonati - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Solution NMR and X-ray crystal structures of Pseudomonas syringae Pspto_3016 from protein domain family PF04237 (DUF419) adopt a double wing DNA binding
    EA Feldmann, J Seetharaman, TA Ramelot - Journal of structural and , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch