.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g7j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the putative cytoplasmic protein ygaC from Salmonella typhimurium. Northeast Structural Genomics target StR72. To be Published
    Site NESGC
    PDB Id 2g7j Target Id StR72
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS9176,PF09400, 7063 Molecular Weight 13312.24 Da.
    Residues 116 Isoelectric Point 6.97
    Sequence mylrpdevarvlekagftvdvvtnktygyrrgenyvyvnrearmgrtaliihprlkdrsssladpasdi ktcdhyqnfplylggethehygiphgfssrialerylnglfgdektd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch