.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g9d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Succinylglutamate desuccinylase from Vibrio cholerae, Northeast Structural Genomics Target VcR20. To be Published
    Site NESGC
    PDB Id 2g9d Target Id VcR20
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS9230,PF04952, 3.40.630.10 Molecular Weight 39090.60 Da.
    Residues 342 Isoelectric Point 6.31
    Sequence mtkslfrqsflfdsldldhpmvaqtvrteqgvtlklhqrgvlevipaqtdaatknmviscgihgdetap melldkwiddivsgfqpvaerclfimahpqatvrhvrfieqnlnrlfddkphtpstelaiadnlkvllr qffantdehsrwhldlhcairgskhysfavspkarhpvrsrslmqfieqahieavmlsnapsstfswys aehyaaqaltlelgqvarlgenlldrllafdlamrdlisrhkpehlprksvmyrvsrtivrlhddfdfr fsddvenftafmhgevfghdgdkplmaknegeaivfpnrkvaigqraalmvckvntryeddqlvyd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.00 Rfree 0.272
    Matthews' coefficent 2.84 Rfactor 0.241
    Waters 17 Solvent Content 56.69

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2g9d
    1. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch