.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g9j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of the Junction between Tropomyosin Molecules: Implications for Actin Binding and Regulation. J.Mol.Biol. 364 80-96 2006
    Site NESGC
    PDB Id 2g9j Target Id OR9
    Molecular Characteristics
    Source Other
    Alias Ids TPS8996,1.20.5.170, 1.20.5.340, 3.30.160.60 Molecular Weight 8053.94 Da.
    Residues 70 Isoelectric Point 6.12
    Sequence gmdaikkkmqmlkldnyhlenevarlkklvgergcgksiddledelyaqklkykaiseeldhalkdmtsi
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2g9j
    1. Solution NMR structure of the junction between tropomyosin molecules: implications for actin binding and regulation
    NJ Greenfield, YJ Huang, GVT Swapna - Journal of molecular , 2006 - Elsevier
     
    2. Tropomyosin: function follows structure
    SE Hitchcock-DeGregori - Tropomyosin, 2008 - Springer
     
    3. Structure of the tropomyosin overlap complex from chicken smooth muscle: insight into the diversity of N-terminal recognition
    J Frye, VA Klenchin, I Rayment - Biochemistry, 2010 - ACS Publications
     
    4. What makes tropomyosin an actin binding protein? A perspective
    SE Hitchcock-DeGregori, A Singh - Journal of structural biology, 2010 - Elsevier
     
    5. Structure of the N Terminus of a Nonmuscle _-Tropomyosin in Complex with the C Terminus: Implications for Actin Binding
    NJ Greenfield, L Kotlyanskaya - Biochemistry, 2009 - ACS Publications
     
    6. Deciphering the role of the electrostatic interactions in the __tropomyosin head_to_tail complex
    F Corra, RK Salinas, AMJJ Bonvin - Proteins: Structure, , 2008 - Wiley Online Library
     
    7. Evolutionarily conserved surface residues constitute actin binding sites of tropomyosin
    B Barua, MC Pamula - Proceedings of the , 2011 - National Acad Sciences
     
    8. SYSTEM AND USES FOR GENERATING DATABASES OF PROTEIN SECONDARY STRUCTURES INVOLVED IN INTER-CHAIN PROTEIN INTERACTIONS
    AL Jochim, PS Arora - US Patent App. 12/753,638, 2010 - Google Patents
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch