.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gan

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Putative Acetyltransferase from Pyrococcus horikoshii, Northeast Structural Genomics Target JR32. To be Published
    Site NESGC
    PDB Id 2gan Target Id JR32
    Molecular Characteristics
    Source Pyrococcus horikoshi
    Alias Ids TPS8941,3.40.630.30, PF00583, PF08445 Molecular Weight 21886.49 Da.
    Residues 182 Isoelectric Point 9.41
    Sequence megvkkiknpstvkdellelmfriyrstngkypalewvkrkpnpndfdgfrevyepflkfrlsqefdel ytyqkdnriigtialvykrikekgiwwvpeelmnekvglieffvvdpefqgkgigstllefavkrlrsl gkdpyvvtfpnleaysyyymkkgfreimrykefvilkfnhkkfq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.254
    Matthews' coefficent 2.35 Rfactor 0.205
    Waters 219 Solvent Content 47.66

    Ligand Information
    Ligands SO4 (SULFATE) x 5;EDO (1,2-ETHANEDIOL) x 2
    Metals

    Jmol

     
    Google Scholar output for 2gan
    1. Re-Annotation of Two Hyperthermophilic Archaea Pyrococcus abyssi GE5 and Pyrococcus furiosus DSM 3638
    J Gao, J Wang - Current microbiology, 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch