.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gbs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics reveals EVE as a new ASCH/PUA-related domain. Proteins 75 760-773 2009
    Site NESGC
    PDB Id 2gbs Target Id RpR3
    Molecular Characteristics
    Source Rhodopseudomonas palustris
    Alias Ids TPS9047,3.10.590.10, 7004, PF01878 Molecular Weight 15222.85 Da.
    Residues 137 Isoelectric Point 8.87
    Sequence maywlvksepsvwswdqqvakgaageawtgvrnhsaklhmvamrrgdrafyyhsnegkeivgiaeiire aypdptdasgkfvcvdikadkplktpvtlaavkaeprladmalmkysrlsvqpvtaeewklvckmggl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gbs
    1. 4D prediction of protein 1 H chemical shifts
    J Lehtivarjo, T Hassinen, SP Korhonen - Journal of biomolecular , 2009 - Springer
     
    2. Efficient discovery of structural motifs from protein sequences with combination of flexible intra-and inter-block gap constraints
    CM Hsu, CY Chen, CC Hsu, BJ Liu - Advances in Knowledge Discovery , 2006 - Springer
     
    3. The YTH domain is a novel RNA binding domain
    Z Zhang, D Theler, KH Kaminska, M Hiller - Journal of Biological , 2010 - ASBMB
     
    4. Structural genomics reveals EVE as a new ASCH/PUA_related domain
    C Bertonati, M Punta, M Fischer - Proteins: Structure, , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch