.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gf4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Vng1086c from Halobacterium salinarium (Halobacterium halobium). Northeast Structural Genomics Target HsR14. To be Published
    Site NESGC
    PDB Id 2gf4 Target Id HsR14
    Molecular Characteristics
    Source Halobacterium sp. (strain nrc-1)
    Alias Ids TPS8931,1.20.1270.110, PF01893 Molecular Weight 10380.95 Da.
    Residues 92 Isoelectric Point 4.75
    Sequence mhkdellelheqmvnikdqflgfdhvdetafaayeeldvepshvhksksehkhavfllgnalaaamsed efssagriskrmeeladdasnql
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.07 Rfree 0.237
    Matthews' coefficent 2.48 Rfactor 0.226
    Waters 150 Solvent Content 50.39

    Ligand Information
    Ligands ACT (ACETATE) x 2
    Metals CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 2gf4
    1. Molecular replacement using ab initio polyalanine models generated with ROSETTA
    DJ Rigden, RM Keegan, MD Winn - Acta Crystallographica Section D , 2008 - scripts.iucr.org
     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch