The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of Xanthomonas campestris XCC1710 protein. To be Published
    Site NESGC
    PDB Id 2gm2 Target Id XcR35
    Molecular Characteristics
    Source Xanthomonas campestris
    Alias Ids TPS9255,PF04430, 7054, 3.40.1230.10 Molecular Weight 13384.65 Da.
    Residues 124 Isoelectric Point 5.42
    Sequence mplnqehpdytyalraadgrhakvneqilqqsfilmpdelvehwpvpslgqlqpahmdavlalnpavil lgtgerqqfpstdvlaacltrgigleamtnaaaartynvlasegrrvalamivgg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch