.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gmg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title PF0610, a novel winged helix-turn-helix variant possessing a rubredoxin-like Zn ribbon motif from the hyperthermophilic archaeon, Pyrococcus furiosus. Biochemistry 46 752-761 2007
    Site NESGC
    PDB Id 2gmg Target Id PfG3
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9014,7074, 2.20.28.10 Molecular Weight 12138.71 Da.
    Residues 105 Isoelectric Point 9.66
    Sequence ahhhhhhgsatrrekiielllegdyspselarildmrgkgskkviledlkviskiakregmvllikpaq crkcgfvfkaeinipsrcpkcksewieeprfklerk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gmg
    1. X-ray structure of the complex of regulatory subunits of human DNA polymerase _
    AG Baranovskiy, ND Babayeva, VG Listen - Cell cycle ( , 2008 - ncbi.nlm.nih.gov
     
    2. PF0610, a novel winged helix-turn-helix variant possessing a rubredoxin-like Zn ribbon motif from the hyperthermophilic archaeon, Pyrococcus furiosus
    X Wang, HS Lee, J Frank, FE Jenney Jr - Biochemistry, 2007 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch