.
The Open Protein Structure Annotation Network
PDB Keyword
.

2go8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of YQJZ_BACSU from Bacillus subtilis. Northeast Structural Genomics TARGET SR435. To be Published
    Site NESGC
    PDB Id 2go8 Target Id SR435
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9096,PF03992, 3.30.70.900 Molecular Weight 13047.76 Da.
    Residues 114 Isoelectric Point 5.32
    Sequence mmdflsktpeppyyavifssvksendtgygetaermvslaadqpgflgvesvreadgrgitvsywdsmd ainhwrhhtehqaakekgrsvwyesyavrvakvdrqrlfqentnd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.255
    Matthews' coefficent 2.19 Rfactor 0.23
    Waters 136 Solvent Content 39.33

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch